APOM monoclonal antibody (M05), clone 2A8
  • APOM monoclonal antibody (M05), clone 2A8

APOM monoclonal antibody (M05), clone 2A8

Ref: AB-H00055937-M05
APOM monoclonal antibody (M05), clone 2A8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant APOM.
Información adicional
Size 100 ug
Gene Name APOM
Gene Alias G3a|HSPC336|MGC22400|NG20
Gene Description apolipoprotein M
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen APOM (AAH20683, 23 a.a. ~ 188 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55937
Clone Number 2A8
Iso type IgG1 Kappa

Enviar uma mensagem


APOM monoclonal antibody (M05), clone 2A8

APOM monoclonal antibody (M05), clone 2A8