NKRF MaxPab mouse polyclonal antibody (B01)
  • NKRF MaxPab mouse polyclonal antibody (B01)

NKRF MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00055922-B01
NKRF MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human NKRF protein.
Información adicional
Size 50 uL
Gene Name NKRF
Gene Alias ITBA4|NRF
Gene Description NFKB repressing factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEKILQMAEGIDIGEMPSYDLVLSKPSKGQKRHLSTCDGQNPPKKQAGSKFHARPRFEPVHFVASSSKDERQEDPYGPQTKEVNEQTHFASMPRDIYQDYTQDSFSIQDGNSQYCDSSGFILTKDQPVTANMYFDSGNPAPSTTSQQANSQSTPEPSPSQTFPESVVAEKQYFIEKLTATIWKNLSNPEMTSGSDKINYTYMLTRCIQACKTNPEYIYAPLKEIPPADIPKNKKLLTDGYACEVRCQNIYLTTGY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NKRF (AAH68514.1, 1 a.a. ~ 690 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 55922

Enviar uma mensagem


NKRF MaxPab mouse polyclonal antibody (B01)

NKRF MaxPab mouse polyclonal antibody (B01)