LANCL2 purified MaxPab mouse polyclonal antibody (B01P)
  • LANCL2 purified MaxPab mouse polyclonal antibody (B01P)

LANCL2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055915-B01P
LANCL2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LANCL2 protein.
Información adicional
Size 50 ug
Gene Name LANCL2
Gene Alias GPR69B|MGC87139|TASP
Gene Description LanC lantibiotic synthetase component C-like 2 (bacterial)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MGETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATTDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LANCL2 (NP_061167.1, 1 a.a. ~ 450 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55915

Enviar uma mensagem


LANCL2 purified MaxPab mouse polyclonal antibody (B01P)

LANCL2 purified MaxPab mouse polyclonal antibody (B01P)