ERBB2IP monoclonal antibody (M02), clone 10D2
  • ERBB2IP monoclonal antibody (M02), clone 10D2

ERBB2IP monoclonal antibody (M02), clone 10D2

Ref: AB-H00055914-M02
ERBB2IP monoclonal antibody (M02), clone 10D2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ERBB2IP.
Información adicional
Size 100 ug
Gene Name ERBB2IP
Gene Alias ERBIN|LAP2
Gene Description erbb2 interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QGHELAKQEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ERBB2IP (NP_061165, 1272 a.a. ~ 1371 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55914
Clone Number 10D2
Iso type IgG2a Kappa

Enviar uma mensagem


ERBB2IP monoclonal antibody (M02), clone 10D2

ERBB2IP monoclonal antibody (M02), clone 10D2