CMAS monoclonal antibody (M01), clone 5A2
  • CMAS monoclonal antibody (M01), clone 5A2

CMAS monoclonal antibody (M01), clone 5A2

Ref: AB-H00055907-M01
CMAS monoclonal antibody (M01), clone 5A2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CMAS.
Información adicional
Size 100 ug
Gene Name CMAS
Gene Alias -
Gene Description cytidine monophosphate N-acetylneuraminic acid synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq EGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CMAS (NP_061156, 164 a.a. ~ 263 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55907
Clone Number 5A2
Iso type IgG2a Kappa

Enviar uma mensagem


CMAS monoclonal antibody (M01), clone 5A2

CMAS monoclonal antibody (M01), clone 5A2