ZNF167 MaxPab mouse polyclonal antibody (B01P)
  • ZNF167 MaxPab mouse polyclonal antibody (B01P)

ZNF167 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055888-B01P
ZNF167 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF167 protein.
Información adicional
Size 50 ug
Gene Name ZNF167
Gene Alias FLJ12738|ZFP|ZKSCAN7|ZNF448|ZNF64
Gene Description zinc finger protein 167
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MTTAGRGNLGLIPRSTAFQKQEGRLTVKQEPANQTWGQGSSLQKNYPPVCEIFRLHFRQLCYHEMSGPQEALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPESGEEAVAVVEDFQRHLSGSEEVSAPAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAHLEPPYDPGTHHLPSGDFAQCTSPVPTLPQVGNSGDQAGATVLRMVRPQDTVAYEDLSVDYTQKKWKSLTLSQRAL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF167 (NP_079445.1, 1 a.a. ~ 276 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55888

Enviar uma mensagem


ZNF167 MaxPab mouse polyclonal antibody (B01P)

ZNF167 MaxPab mouse polyclonal antibody (B01P)