PBK MaxPab rabbit polyclonal antibody (D01)
  • PBK MaxPab rabbit polyclonal antibody (D01)

PBK MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00055872-D01
PBK MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PBK protein.
Información adicional
Size 100 uL
Gene Name PBK
Gene Alias FLJ14385|Nori-3|SPK|TOPK
Gene Description PDZ binding kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PBK (NP_060962.2, 1 a.a. ~ 322 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 55872

Enviar uma mensagem


PBK MaxPab rabbit polyclonal antibody (D01)

PBK MaxPab rabbit polyclonal antibody (D01)