HDAC8 monoclonal antibody (M07), clone 2F4
  • HDAC8 monoclonal antibody (M07), clone 2F4

HDAC8 monoclonal antibody (M07), clone 2F4

Ref: AB-H00055869-M07
HDAC8 monoclonal antibody (M07), clone 2F4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HDAC8.
Información adicional
Size 100 ug
Gene Name HDAC8
Gene Alias HDACL1|RPD3
Gene Description histone deacetylase 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HDAC8 (NP_060956.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55869
Clone Number 2F4
Iso type IgG2a Kappa

Enviar uma mensagem


HDAC8 monoclonal antibody (M07), clone 2F4

HDAC8 monoclonal antibody (M07), clone 2F4