SLC22A11 DNAxPab
  • SLC22A11 DNAxPab

SLC22A11 DNAxPab

Ref: AB-H00055867-W01P
SLC22A11 DNAxPab

Información del producto

Rabbit polyclonal antibody raised against a partial-length human SLC22A11 DNA using DNAx™ Immune technology.
Información adicional
Size 100 ug
Gene Name SLC22A11
Gene Alias MGC34282|OAT4|hOAT4
Gene Description solute carrier family 22 (organic anion/urate transporter), member 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF-Tr,Flow Cyt-Tr
Immunogen Prot. Seq PSQMLLENFSAAIPGHRCWTHMLDNGSAVSTNMTPKALLTISIPPGPNQGPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYDRSVFTSTIVAKWDLVCSSQGLK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC22A11 (NP_060954.1, 32 a.a. ~ 142 a.a) partial-length human DNA
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55867

Enviar uma mensagem


SLC22A11 DNAxPab

SLC22A11 DNAxPab