TMEM126B MaxPab rabbit polyclonal antibody (D01)
  • TMEM126B MaxPab rabbit polyclonal antibody (D01)

TMEM126B MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00055863-D01
TMEM126B MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TMEM126B protein.
Información adicional
Size 100 uL
Gene Name TMEM126B
Gene Alias HT007|MGC111203
Gene Description transmembrane protein 126B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MAASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTTAGFSGIFSNFLFRRCFKVKHDALKTYASLATLPFLSTVVTDKLFVIDALYSDNISKENCVFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLCQTQMKLMAIPLVFQIMFGILNGLYHYAVFEETLEKTIHEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TMEM126B (NP_060950.2, 1 a.a. ~ 200 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 55863

Enviar uma mensagem


TMEM126B MaxPab rabbit polyclonal antibody (D01)

TMEM126B MaxPab rabbit polyclonal antibody (D01)