USE1 purified MaxPab rabbit polyclonal antibody (D01P)
  • USE1 purified MaxPab rabbit polyclonal antibody (D01P)

USE1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055850-D01P
USE1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human USE1 protein.
Información adicional
Size 100 ug
Gene Name USE1
Gene Alias MDS032|P31|SLT1
Gene Description unconventional SNARE in the ER 1 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MAASRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINEYSWKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTARERVPATKTVHLQSRARYTSEMRSELLGTDSAEPEMDVRKRTGVAGSQPVSEKQSAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKSVNWLLWAMLIIVCFIFISMILFIRIM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen USE1 (NP_060937.1, 1 a.a. ~ 259 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55850

Enviar uma mensagem


USE1 purified MaxPab rabbit polyclonal antibody (D01P)

USE1 purified MaxPab rabbit polyclonal antibody (D01P)