MDS028 monoclonal antibody (M03), clone 2C7 View larger

Mouse monoclonal antibody raised against a full length recombinant MDS028.

AB-H00055846-M03

New product

MDS028 monoclonal antibody (M03), clone 2C7

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name ITFG2
Gene Alias MDS028
Gene Description integrin alpha FG-GAP repeat containing 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MRSVSYVQRVALEFSGSLFPHAICLGDVDNDTLNELVVGDTSGKVSVYKNDDSRPWLTCSCQGMLTCVGVGDVCNKGKNLLVAVSAEGWFHLFDLTPAKVLDASGHHETLIGEEQRPVFKQHIPANTKVMLISDIDGDGCRELVVGYTDRVVRAFRWEELGEGPEHLTGQLVSLKKWMLEGQVDSLSVTLGPLGLPELMVSQPGCAYAILLCTWKKDTGSPPASEGPTDGSRETPAARDVVLHQTSGRIHNKNVS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MDS028 (AAH06552, 1 a.a. ~ 447 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55846
Clone Number 2C7
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a full length recombinant MDS028.

Enviar uma mensagem

Mouse monoclonal antibody raised against a full length recombinant MDS028.

Mouse monoclonal antibody raised against a full length recombinant MDS028.