ITFG2 purified MaxPab rabbit polyclonal antibody (D01P)
  • ITFG2 purified MaxPab rabbit polyclonal antibody (D01P)

ITFG2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055846-D01P
ITFG2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ITFG2 protein.
Información adicional
Size 100 ug
Gene Name ITFG2
Gene Alias MDS028
Gene Description integrin alpha FG-GAP repeat containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MRSVSYVQRVALEFSGSLFPHAICLGDVDNDTLNELVVGDTSGKVSVYKNDDSRPWLTCSCQGMLTCVGVGDVCNKGKNLLVAVSAEGWFHLFDLTPAKVLDASGHHETLIGEEQRPVFKQHIPANTKVMLISDIDGDGCRELVVGYTDRVVRAFRWEELGEGPEHLTGQLVSLKKWMLEGQVDSLSVTLGPLGLPELMVSQPGCAYAILLCTWKKDTGSPPASEGPTDGSRETPAARDVVLHQTSGRIHNKNVS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ITFG2 (AAH13399.1, 1 a.a. ~ 447 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55846

Enviar uma mensagem


ITFG2 purified MaxPab rabbit polyclonal antibody (D01P)

ITFG2 purified MaxPab rabbit polyclonal antibody (D01P)