Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
VPS11 monoclonal antibody (M01), clone 1H1
Abnova
VPS11 monoclonal antibody (M01), clone 1H1
Ref: AB-H00055823-M01
VPS11 monoclonal antibody (M01), clone 1H1
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant VPS11.
Información adicional
Size
100 ug
Gene Name
VPS11
Gene Alias
END1|PEP5|RNF108|hVPS11
Gene Description
vacuolar protein sorting 11 homolog (S. cerevisiae)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq
FHQHCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHDQFQHQLRCSNDSFSVIADYFGRGVFNKLTLLTDPPTARLTSSLEAGLQRDLLMHSRRGT
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
VPS11 (NP_068375, 842 a.a. ~ 941 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
55823
Clone Number
1H1
Iso type
IgG2b Kappa
Enviar uma mensagem
VPS11 monoclonal antibody (M01), clone 1H1
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*