DCP1A polyclonal antibody (A01)
  • DCP1A polyclonal antibody (A01)

DCP1A polyclonal antibody (A01)

Ref: AB-H00055802-A01
DCP1A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DCP1A.
Información adicional
Size 50 uL
Gene Name DCP1A
Gene Alias FLJ21691|HSA275986|Nbla00360|SMAD4IP1|SMIF
Gene Description DCP1 decapping enzyme homolog A (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55802

Enviar uma mensagem


DCP1A polyclonal antibody (A01)

DCP1A polyclonal antibody (A01)