RIOK2 MaxPab rabbit polyclonal antibody (D01)
  • RIOK2 MaxPab rabbit polyclonal antibody (D01)

RIOK2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00055781-D01
RIOK2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RIOK2 protein.
Información adicional
Size 100 uL
Gene Name RIOK2
Gene Alias FLJ11159
Gene Description RIO kinase 2 (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP,IF
Immunogen Prot. Seq MGKVNVAKLRYMSRDDFRVLTAVEMGMKNHEIVPGSLIASIASLKHGGCNKVLRELVKHKLIAWERTKTVQGYRLTNAGYDYLALKTLSSRQVVESVGNQMGVGKESDIYIVANEEGQQFALKLHRLGRTSFRNLKNKRDYHKYRHNVSWLYLSRLSAMKEFAYMKALYERKFPVPKPIDYNRHAVVMELINGYPLCQIHHVEDPASVYDEAMELIVKLANHGLIHGDFNEFNLILDESDHITMIDFPQMVSTSH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RIOK2 (AAH00953.1, 1 a.a. ~ 552 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 55781

Enviar uma mensagem


RIOK2 MaxPab rabbit polyclonal antibody (D01)

RIOK2 MaxPab rabbit polyclonal antibody (D01)