MBD5 polyclonal antibody (A01)
  • MBD5 polyclonal antibody (A01)

MBD5 polyclonal antibody (A01)

Ref: AB-H00055777-A01
MBD5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant MBD5.
Información adicional
Size 50 uL
Gene Name MBD5
Gene Alias FLJ11113|FLJ30517|KIAA1461|MRD1
Gene Description methyl-CpG binding domain protein 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MFPPTANMLLPTGEGQSGRAALRDKLMSQQKDALRKRKQPPTTVLSLLRQSQMDSSAVPKPGPDLLRKQGQGSFPISSMSQLLQSMSCQSSHLSSNSTPGCGASNTALPCSANQLHFTDPSMNSSVLQNIPLRGEAVHCHNANTNFVHSNSPVPNHHLAGLINQIQASGNCGMLSQSGMALGNSLHPNPPQSRISTSSTPVIPNSIVSSYNQTSSEAGMVLLEKSTQRY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MBD5 (AAH14534.1, 1 a.a. ~ 229 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55777

Enviar uma mensagem


MBD5 polyclonal antibody (A01)

MBD5 polyclonal antibody (A01)