TDP1 purified MaxPab mouse polyclonal antibody (B01P)
  • TDP1 purified MaxPab mouse polyclonal antibody (B01P)

TDP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055775-B01P
TDP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TDP1 protein.
Información adicional
Size 50 ug
Gene Name TDP1
Gene Alias FLJ11090|MGC104252
Gene Description tyrosyl-DNA phosphodiesterase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKEEEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDWLVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TDP1 (NP_001008744.1, 1 a.a. ~ 608 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55775

Enviar uma mensagem


TDP1 purified MaxPab mouse polyclonal antibody (B01P)

TDP1 purified MaxPab mouse polyclonal antibody (B01P)