TDP1 polyclonal antibody (A01)
  • TDP1 polyclonal antibody (A01)

TDP1 polyclonal antibody (A01)

Ref: AB-H00055775-A01
TDP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant TDP1.
Información adicional
Size 50 uL
Gene Name TDP1
Gene Alias FLJ11090|MGC104252
Gene Description tyrosyl-DNA phosphodiesterase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKEEEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDWLVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TDP1 (AAH15474.1, 1 a.a. ~ 608 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55775

Enviar uma mensagem


TDP1 polyclonal antibody (A01)

TDP1 polyclonal antibody (A01)