DHX32 monoclonal antibody (M02), clone 2G4
  • DHX32 monoclonal antibody (M02), clone 2G4

DHX32 monoclonal antibody (M02), clone 2G4

Ref: AB-H00055760-M02
DHX32 monoclonal antibody (M02), clone 2G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DHX32.
Información adicional
Size 100 ug
Gene Name DHX32
Gene Alias DDX32|DHLP1|FLJ10694|FLJ10889
Gene Description DEAH (Asp-Glu-Ala-His) box polypeptide 32
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq QVAQLHPLSGYSITKKMPEWVLFHKFSISENNYIRITSEISPELFMQLVPQYYFSNLPPSESKDILQQVVDHLSPVSTMNKEQQMCETCPETEQRCTLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DHX32 (NP_060650.2, 645 a.a. ~ 743 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55760
Clone Number 2G4
Iso type IgG2a Kappa

Enviar uma mensagem


DHX32 monoclonal antibody (M02), clone 2G4

DHX32 monoclonal antibody (M02), clone 2G4