UGCGL2 polyclonal antibody (A01)
  • UGCGL2 polyclonal antibody (A01)

UGCGL2 polyclonal antibody (A01)

Ref: AB-H00055757-A01
UGCGL2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant UGCGL2.
Información adicional
Size 50 uL
Gene Name UGCGL2
Gene Alias FLJ10873|FLJ11485|HUGT2|MGC117360|MGC150689|MGC87276
Gene Description UDP-glucose ceramide glucosyltransferase-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAPAKATNVVRLLLGSTALWLSQLGSGTVAASKSVTAHLAAKWPETPLLLEASEFMAEESNEKFWQFLETVQELAIYKQTESDYSYYNLILKKAGQFLDNLHINLLKFAFSIRAYSPAIQMFQQIAADEPPPDGCNAFVVIHKKHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTRTFSAFHKVLSEKAQNEEILYVLRHYIQKPSSRKMYLSGYGVELAIKSTEYKALDDTQVKTVT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UGCGL2 (AAH32302, 1 a.a. ~ 278 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55757

Enviar uma mensagem


UGCGL2 polyclonal antibody (A01)

UGCGL2 polyclonal antibody (A01)