SEPT11 monoclonal antibody (M02), clone 1E5
  • SEPT11 monoclonal antibody (M02), clone 1E5

SEPT11 monoclonal antibody (M02), clone 1E5

Ref: AB-H00055752-M02
SEPT11 monoclonal antibody (M02), clone 1E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SEPT11.
Información adicional
Size 100 ug
Gene Name SEPT11
Gene Alias -
Gene Description septin 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYID
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEPT11 (AAH08083, 71 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55752
Clone Number 1E5
Iso type IgG2b Lambda

Enviar uma mensagem


SEPT11 monoclonal antibody (M02), clone 1E5

SEPT11 monoclonal antibody (M02), clone 1E5