CNDP2 monoclonal antibody (M09), clone 1B1
  • CNDP2 monoclonal antibody (M09), clone 1B1

CNDP2 monoclonal antibody (M09), clone 1B1

Ref: AB-H00055748-M09
CNDP2 monoclonal antibody (M09), clone 1B1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CNDP2.
Información adicional
Size 100 ug
Gene Name CNDP2
Gene Alias CN2|CPGL|FLJ10830|HsT2298|PEPA
Gene Description CNDP dipeptidase 2 (metallopeptidase M20 family)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VCISDNYWLGKKKPCITYGLRGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDIDFDIEEFAKDVGAQILLHSH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CNDP2 (NP_060705, 191 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55748
Clone Number 1B1
Iso type IgG2a Kappa

Enviar uma mensagem


CNDP2 monoclonal antibody (M09), clone 1B1

CNDP2 monoclonal antibody (M09), clone 1B1