C7orf44 purified MaxPab mouse polyclonal antibody (B02P)
  • C7orf44 purified MaxPab mouse polyclonal antibody (B02P)

C7orf44 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00055744-B02P
C7orf44 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C7orf44 protein.
Información adicional
Size 50 ug
Gene Name C7orf44
Gene Alias FLJ10803
Gene Description chromosome 7 open reading frame 44
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MMWQKYAGSRRSMPLGARILFHGVFYAGGFAIVYYLIQKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSKGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C7orf44 (AAH56884, 1 a.a. ~ 146 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55744

Enviar uma mensagem


C7orf44 purified MaxPab mouse polyclonal antibody (B02P)

C7orf44 purified MaxPab mouse polyclonal antibody (B02P)