N4BP2 polyclonal antibody (A01)
  • N4BP2 polyclonal antibody (A01)

N4BP2 polyclonal antibody (A01)

Ref: AB-H00055728-A01
N4BP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant N4BP2.
Información adicional
Size 50 uL
Gene Name N4BP2
Gene Alias B3BP|FLJ10680|KIAA1413
Gene Description NEDD4 binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq HLAAIEIFEKVNASLLPQNVLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen N4BP2 (NP_060647, 1671 a.a. ~ 1770 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55728

Enviar uma mensagem


N4BP2 polyclonal antibody (A01)

N4BP2 polyclonal antibody (A01)