DSU monoclonal antibody (M01), clone 8F9-1B2
  • DSU monoclonal antibody (M01), clone 8F9-1B2

DSU monoclonal antibody (M01), clone 8F9-1B2

Ref: AB-H00055686-M01
DSU monoclonal antibody (M01), clone 8F9-1B2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant DSU.
Información adicional
Size 100 ug
Gene Name MREG
Gene Alias DSU|FLJ10116|MGC90296|WDT2
Gene Description melanoregulin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLPFPSP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DSU (AAH32747, 1 a.a. ~ 214 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55686
Clone Number 8F9-1B2
Iso type IgG1 kappa

Enviar uma mensagem


DSU monoclonal antibody (M01), clone 8F9-1B2

DSU monoclonal antibody (M01), clone 8F9-1B2