PEX26 purified MaxPab mouse polyclonal antibody (B01P)
  • PEX26 purified MaxPab mouse polyclonal antibody (B01P)

PEX26 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055670-B01P
PEX26 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PEX26 protein.
Información adicional
Size 50 ug
Gene Name PEX26
Gene Alias FLJ20695|PEX26M1T|Pex26pM1T
Gene Description peroxisomal biogenesis factor 26
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MKSDSSTSAAPLRGLGGPLRSSEPVRAVPARAPAVDLLEEAADLLVVHLDFRAALETCERAWQSLANHAVAEEPAGTSLEVKCSLCVVGIQALAEMDRWQEVLSWVLQYYQVPEKLPPKVLELCILLYSKMQEPGAVLDVVGAWLQDPANQNLPEYGALAEFHVQRVLLPLGCLSEAEELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHKFLSLPMLVRQLWDSAVSHFFSLPFKKS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PEX26 (NP_060399.1, 1 a.a. ~ 305 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55670

Enviar uma mensagem


PEX26 purified MaxPab mouse polyclonal antibody (B01P)

PEX26 purified MaxPab mouse polyclonal antibody (B01P)