MFN1 polyclonal antibody (A01)
  • MFN1 polyclonal antibody (A01)

MFN1 polyclonal antibody (A01)

Ref: AB-H00055669-A01
MFN1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MFN1.
Información adicional
Size 50 uL
Gene Name MFN1
Gene Alias DKFZp762F247|FLJ20693|MGC41806|hfzo1|hfzo2
Gene Description mitofusin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MAEPVSPLKHFVLAKKAITAIFDQLLEFVTEGSHFVEATYKNPELDRIATEDDLVEMQGYKDKLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MFN1 (NP_060397, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55669

Enviar uma mensagem


MFN1 polyclonal antibody (A01)

MFN1 polyclonal antibody (A01)