HIF1AN polyclonal antibody (A01)
  • HIF1AN polyclonal antibody (A01)

HIF1AN polyclonal antibody (A01)

Ref: AB-H00055662-A01
HIF1AN polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant HIF1AN.
Información adicional
Size 50 uL
Gene Name HIF1AN
Gene Alias DKFZp762F1811|FIH1|FLJ20615|FLJ22027
Gene Description hypoxia inducible factor 1, alpha subunit inhibitor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIF1AN (AAH07719.1, 1 a.a. ~ 349 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55662

Enviar uma mensagem


HIF1AN polyclonal antibody (A01)

HIF1AN polyclonal antibody (A01)