NLRP2 monoclonal antibody (M06), clone 1B10
  • NLRP2 monoclonal antibody (M06), clone 1B10

NLRP2 monoclonal antibody (M06), clone 1B10

Ref: AB-H00055655-M06
NLRP2 monoclonal antibody (M06), clone 1B10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant NLRP2.
Información adicional
Size 100 ug
Gene Name NLRP2
Gene Alias CLR19.9|FLJ20510|NALP2|NBS1|PAN1|PYPAF2
Gene Description NLR family, pyrin domain containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEVLTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSKEVQVMAERYKMLIPFSNPRVLPGPFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYLSCRELSRLGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NLRP2 (AAH39269, 1 a.a. ~ 846 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55655
Clone Number 1B10
Iso type IgG2a Kappa

Enviar uma mensagem


NLRP2 monoclonal antibody (M06), clone 1B10

NLRP2 monoclonal antibody (M06), clone 1B10