OSGEP purified MaxPab mouse polyclonal antibody (B01P)
  • OSGEP purified MaxPab mouse polyclonal antibody (B01P)

OSGEP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055644-B01P
OSGEP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human OSGEP protein.
Información adicional
Size 50 ug
Gene Name OSGEP
Gene Alias FLJ20411|GCPL1|KAE1|OSGEP1|PRSMG1
Gene Description O-sialoglycoprotein endopeptidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPAVLGFEGSANKIGVGVVRDGKVLANPRRTYVTPPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGPGMGAPLVSVAVVARTVAQLWNKPLVGVNHCIGHIEMGRLITGATSPTVLYVSGGNTQVIAYSEHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSFIEDVAHRMLATGECTPEDLCFSLQETVFAMLVEITERAMAHCGSQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen OSGEP (NP_060277.1, 1 a.a. ~ 335 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55644

Enviar uma mensagem


OSGEP purified MaxPab mouse polyclonal antibody (B01P)

OSGEP purified MaxPab mouse polyclonal antibody (B01P)