DEPDC1 monoclonal antibody (M05), clone 6H1
  • DEPDC1 monoclonal antibody (M05), clone 6H1

DEPDC1 monoclonal antibody (M05), clone 6H1

Ref: AB-H00055635-M05
DEPDC1 monoclonal antibody (M05), clone 6H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DEPDC1.
Información adicional
Size 100 ug
Gene Name DEPDC1
Gene Alias DEP.8|DEPDC1-V2|DEPDC1A|FLJ20354|SDP35
Gene Description DEP domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq GSENVDDNNQLFRFPATSPLKTLPRRYPELRKNNIENFSKDKDSIFKLRNLSRRTPKRHGLHLSQENGEKIKHEIINEDQENAIDNRELSQEDV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DEPDC1 (NP_060249, 93 a.a. ~ 186 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55635
Clone Number 6H1
Iso type IgG2a Lambda

Enviar uma mensagem


DEPDC1 monoclonal antibody (M05), clone 6H1

DEPDC1 monoclonal antibody (M05), clone 6H1