KIAA1333 polyclonal antibody (A01)
  • KIAA1333 polyclonal antibody (A01)

KIAA1333 polyclonal antibody (A01)

Ref: AB-H00055632-A01
KIAA1333 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KIAA1333.
Información adicional
Size 50 uL
Gene Name KIAA1333
Gene Alias FLJ20333|G2E3|PHF7B
Gene Description KIAA1333
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NESKPGDSQNLACVFCRKHDDCPNKYGEKKTKEKWNLTVHYYCLLMSSGIWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KIAA1333 (NP_060239, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55632

Enviar uma mensagem


KIAA1333 polyclonal antibody (A01)

KIAA1333 polyclonal antibody (A01)