LRRC40 monoclonal antibody (M02), clone 3E10
  • LRRC40 monoclonal antibody (M02), clone 3E10

LRRC40 monoclonal antibody (M02), clone 3E10

Ref: AB-H00055631-M02
LRRC40 monoclonal antibody (M02), clone 3E10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant LRRC40.
Información adicional
Size 100 ug
Gene Name LRRC40
Gene Alias FLJ20331|RP4-677H15.1|dJ677H15.1
Gene Description leucine rich repeat containing 40
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSRLKRIAGQDLRAGFKAGGRDCGTSVPQGLLKAARKSGQLNLSGRNLSEVPQCVWRINVDIPEEANQNLSFGATERWWEQTDLTKLIISNNKLQSLTDDLRLLPALTVLDIHDNQLTSLPSAIRELENLQKLNVSHNKLKILPEEITNLRNLKCLYLQHNELTCISEGFEQLSNLEDLDLSNNHLTTVPASFSSLSSLVRLNLSSNELKSLPAEINRMKRLKHLDCNSNLLETIPPELAGMESLELLYLRRNKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LRRC40 (NP_060238.3, 1 a.a. ~ 602 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55631
Clone Number 3E10
Iso type IgG2b Kappa

Enviar uma mensagem


LRRC40 monoclonal antibody (M02), clone 3E10

LRRC40 monoclonal antibody (M02), clone 3E10