C20orf23 purified MaxPab mouse polyclonal antibody (B01P)
  • C20orf23 purified MaxPab mouse polyclonal antibody (B01P)

C20orf23 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055614-B01P
C20orf23 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C20orf23 protein.
Información adicional
Size 50 ug
Gene Name KIF16B
Gene Alias C20orf23|KISC20ORF|SNX23
Gene Description kinesin family member 16B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASVKVAVRVRPMNRREKDLEAKFIIQMEKSKTTITNLKIPEGGTGDSGRERTKTFTYDFSFYSADTKSPDYVSQEMVFKTLGTDVVKSAFEGYNACVFAYGQTGSGKSYTMMGNSGDSGLIPRICEGLFSRINETTRWDEASFRTEVSYLEIYNERVRDLLRRKSSKTFNLRVREHPKEGPYVEDLSKHLVQNYGDVEELMDAGNINRTTAATGMNDVSSRSHAIFTIKFTQAKFDSEMPCETVSKIHLVDLAG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C20orf23 (NP_078980, 1 a.a. ~ 1317 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55614

Enviar uma mensagem


C20orf23 purified MaxPab mouse polyclonal antibody (B01P)

C20orf23 purified MaxPab mouse polyclonal antibody (B01P)