PPP1R9A monoclonal antibody (M01), clone 6A10
  • PPP1R9A monoclonal antibody (M01), clone 6A10

PPP1R9A monoclonal antibody (M01), clone 6A10

Ref: AB-H00055607-M01
PPP1R9A monoclonal antibody (M01), clone 6A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPP1R9A.
Información adicional
Size 100 ug
Gene Name PPP1R9A
Gene Alias FLJ20068|KIAA1222|NRB1|NRBI|Neurabin-I
Gene Description protein phosphatase 1, regulatory (inhibitor) subunit 9A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PCSTAQTSTRSPCMPFSWFNDSRKGSYSFRNLPAPTSSLQPSPETLISDKKGSKNFTFNDDFSPSSTSSADLSGLGAEPKTPGLSQSLALSSDESLDMI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP1R9A (XP_371933, 1090 a.a. ~ 1188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55607
Clone Number 6A10
Iso type IgG1 Kappa

Enviar uma mensagem


PPP1R9A monoclonal antibody (M01), clone 6A10

PPP1R9A monoclonal antibody (M01), clone 6A10