CDKN2AIP purified MaxPab rabbit polyclonal antibody (D01P)
  • CDKN2AIP purified MaxPab rabbit polyclonal antibody (D01P)

CDKN2AIP purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055602-D01P
CDKN2AIP purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CDKN2AIP protein.
Información adicional
Size 100 ug
Gene Name CDKN2AIP
Gene Alias CARF|FLJ20036
Gene Description CDKN2A interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAQEVSEYLSQNPRVAAWVEALRCDGETDKHWRHRRDFLLRNAGDLAPAGGAASASTDEAADAESGTRNRQLQQLISFSMAWANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDELVAKVKKRGISSSNEGVEEPSKKRVIEGKNSSAVEQDHAKTSAKTERASAQQENSSTCIGSAIKSESGNSARSSGISSQNSSTSDGDRSVSSQSSSSVSSQVTTAGSGKASEAEAPDKHGSSFVSLLKSSVNSHM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDKN2AIP (AAH22270.1, 1 a.a. ~ 579 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55602

Enviar uma mensagem


CDKN2AIP purified MaxPab rabbit polyclonal antibody (D01P)

CDKN2AIP purified MaxPab rabbit polyclonal antibody (D01P)