DDX60 monoclonal antibody (M02), clone 1A10
  • DDX60 monoclonal antibody (M02), clone 1A10

DDX60 monoclonal antibody (M02), clone 1A10

Ref: AB-H00055601-M02
DDX60 monoclonal antibody (M02), clone 1A10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant DDX60.
Información adicional
Size 100 ug
Gene Name DDX60
Gene Alias FLJ10787|FLJ20035
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 60
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MKIMEDFTTFLRIVSKLADMNQEYQLPLSKIKFTGKECEDSQLVSHLMSCKEGRVAISPFVCLSGNFDDDLLRLETPNHVTLGTIGVNRSQAPVLLSQKFDNRGRKMSLNAYALDFYKHGSLIGLVQDNRMNEGDAYYLLKDFALTIKSISVSLRELCENEDDNVVLAFEQLSTTFWEKLNKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDX60 (AAH20601.1, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55601
Clone Number 1A10
Iso type IgG1 Kappa

Enviar uma mensagem


DDX60 monoclonal antibody (M02), clone 1A10

DDX60 monoclonal antibody (M02), clone 1A10