BMP2K monoclonal antibody (M03), clone X1
  • BMP2K monoclonal antibody (M03), clone X1

BMP2K monoclonal antibody (M03), clone X1

Ref: AB-H00055589-M03
BMP2K monoclonal antibody (M03), clone X1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant BMP2K.
Información adicional
Size 100 ug
Gene Name BMP2K
Gene Alias BIKE|DKFZp434K0614|DKFZp434P0116|HRIHFB2017
Gene Description BMP2 inducible kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq YQQAFFQQQMLAQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSVADKEAIANFTNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BMP2K (AAH36021, 540 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55589
Clone Number X1
Iso type IgG2a Kappa

Enviar uma mensagem


BMP2K monoclonal antibody (M03), clone X1

BMP2K monoclonal antibody (M03), clone X1