CDV3 MaxPab mouse polyclonal antibody (B01)
  • CDV3 MaxPab mouse polyclonal antibody (B01)

CDV3 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00055573-B01
CDV3 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human CDV3 protein.
Información adicional
Size 50 uL
Gene Name CDV3
Gene Alias H41
Gene Description CDV3 homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAETEERSLDNFFAKRDKKKKKERSNRAASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATKAVTKDEDEWKELEQKEVDYSGLRVQAMQISSEKEEDDNEKRQDPGDNWEEGGGGGGGMEKSSGPWNKTAPVQAPPAPVIVTETPEPAMTSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHVESRNRYLK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDV3 (AAH07338, 1 a.a. ~ 213 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 55573

Enviar uma mensagem


CDV3 MaxPab mouse polyclonal antibody (B01)

CDV3 MaxPab mouse polyclonal antibody (B01)