GALNT10 purified MaxPab mouse polyclonal antibody (B01P)
  • GALNT10 purified MaxPab mouse polyclonal antibody (B01P)

GALNT10 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055568-B01P
GALNT10 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GALNT10 protein.
Información adicional
Size 50 ug
Gene Name GALNT10
Gene Alias DKFZp586H0623|FLJ00205|FLJ11715|GalNAcT10|pp-GalNAc-T10
Gene Description UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRRKEKRLLQAVALVLAALVLLPNVGLWALYRERQPDGTPGGSGAAVAPAAGQGSHSRQKKTFFLGDGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GALNT10 (AAI53182.1, 1 a.a. ~ 603 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55568

Enviar uma mensagem


GALNT10 purified MaxPab mouse polyclonal antibody (B01P)

GALNT10 purified MaxPab mouse polyclonal antibody (B01P)