GALNT10 polyclonal antibody (A01)
  • GALNT10 polyclonal antibody (A01)

GALNT10 polyclonal antibody (A01)

Ref: AB-H00055568-A01
GALNT10 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GALNT10.
Información adicional
Size 50 uL
Gene Name GALNT10
Gene Alias DKFZp586H0623|FLJ00205|FLJ11715|GalNAcT10|pp-GalNAc-T10
Gene Description UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GALNT10 (NP_938080, 503 a.a. ~ 602 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55568

Enviar uma mensagem


GALNT10 polyclonal antibody (A01)

GALNT10 polyclonal antibody (A01)