TRIM36 monoclonal antibody (M02), clone 1G11
  • TRIM36 monoclonal antibody (M02), clone 1G11

TRIM36 monoclonal antibody (M02), clone 1G11

Ref: AB-H00055521-M02
TRIM36 monoclonal antibody (M02), clone 1G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRIM36.
Información adicional
Size 100 ug
Gene Name TRIM36
Gene Alias HAPRIN|RBCC728|RNF98
Gene Description tripartite motif-containing 36
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq TSFEDYVVNTSKQTELLGELSFFSSGIDVPEINEEQSKVYNNALINWHHPEKDKADSYVLEYRKINRDDEMSWNEIEVCGTSKIIQDLENSSTYAFRVRAYKGSICSPC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM36 (NP_061170, 391 a.a. ~ 499 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55521
Clone Number 1G11
Iso type IgG1 Kappa

Enviar uma mensagem


TRIM36 monoclonal antibody (M02), clone 1G11

TRIM36 monoclonal antibody (M02), clone 1G11