SMPD3 purified MaxPab mouse polyclonal antibody (B01P)
  • SMPD3 purified MaxPab mouse polyclonal antibody (B01P)

SMPD3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055512-B01P
SMPD3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SMPD3 protein.
Información adicional
Size 50 ug
Gene Name SMPD3
Gene Alias FLJ22593|MGC138443|NSMASE2
Gene Description sphingomyelin phosphodiesterase 3, neutral membrane (neutral sphingomyelinase II)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVLYTTPFPNSCLSALHCVSWALIFPCYWLVDRLAASFIPTTYEKRQRADDPCCLQLLCTALFTPIYLALLVASLPFAFLGFLFWSPLQSARRPYIYSRLEDKGLAGGAALLSEWKGTGPGKSFCFATANVCLLPDSLARVNNLFNTQARAKEIGQRIRNGAARPQIKIYIDSPTNTSISAASFSSLVSPQGGDGVARAVPGSIKRTASVEYKGDGGRHPGDEAANGPASGDPVDSSSPEDACIVRIGGEEGGRP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SMPD3 (NP_061137.1, 1 a.a. ~ 655 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55512

Enviar uma mensagem


SMPD3 purified MaxPab mouse polyclonal antibody (B01P)

SMPD3 purified MaxPab mouse polyclonal antibody (B01P)