DDX43 purified MaxPab rabbit polyclonal antibody (D01P)
  • DDX43 purified MaxPab rabbit polyclonal antibody (D01P)

DDX43 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055510-D01P
DDX43 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DDX43 protein.
Información adicional
Size 100 ug
Gene Name DDX43
Gene Alias DKFZp434H2114|HAGE
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 43
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSHHGGAPKASTWVVASRRSSTVSRAPERRPAEELNRTGPEGYSVGRGGRWRGTSRPPEDVAAGHEELPLCFALKSHFVGAVIGRGGSKIKNIQSTTNTTIQIIQEQPESLVKIFGSKAMQTKAKAVIDNFVKKLEENYNSECGIDTAFQPSVGKDGSTDNNVVAGDRPLIDWDQIREEGLKWQKTKWADLPPIKKNFYKESTATSAMSKVEADSWRKENFNITWDDLKDGEKRPIPNPTCTFDDAFQCYPEVME
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DDX43 (AAH66938.1, 1 a.a. ~ 648 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55510

Enviar uma mensagem


DDX43 purified MaxPab rabbit polyclonal antibody (D01P)

DDX43 purified MaxPab rabbit polyclonal antibody (D01P)