GPRC5D monoclonal antibody (M01), clone 6D9
  • GPRC5D monoclonal antibody (M01), clone 6D9

GPRC5D monoclonal antibody (M01), clone 6D9

Ref: AB-H00055507-M01
GPRC5D monoclonal antibody (M01), clone 6D9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GPRC5D.
Información adicional
Size 100 ug
Gene Name GPRC5D
Gene Alias MGC129713|MGC129714
Gene Description G protein-coupled receptor, family C, group 5, member D
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GPRC5D (NP_061124, 261 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55507
Clone Number 6D9
Iso type IgG2b Kappa

Enviar uma mensagem


GPRC5D monoclonal antibody (M01), clone 6D9

GPRC5D monoclonal antibody (M01), clone 6D9