ETNK1 polyclonal antibody (A01)
  • ETNK1 polyclonal antibody (A01)

ETNK1 polyclonal antibody (A01)

Ref: AB-H00055500-A01
ETNK1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ETNK1.
Información adicional
Size 50 uL
Gene Name ETNK1
Gene Alias EKI|EKI1|Nbla10396
Gene Description ethanolamine kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq WDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ETNK1 (NP_061108, 133 a.a. ~ 228 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55500

Enviar uma mensagem


ETNK1 polyclonal antibody (A01)

ETNK1 polyclonal antibody (A01)