DNAJA4 polyclonal antibody (A01)
  • DNAJA4 polyclonal antibody (A01)

DNAJA4 polyclonal antibody (A01)

Ref: AB-H00055466-A01
DNAJA4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant DNAJA4.
Información adicional
Size 50 uL
Gene Name DNAJA4
Gene Alias MST104|MSTP104|PRO1472
Gene Description DnaJ (Hsp40) homolog, subfamily A, member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEKFKLISQAYEVLSDPKKRDVYDQGGEQAIKEGGSGSPSFSSPMDIFDMFFGGGGRMARERRGKNVVHQLSVTLEDLYNGVTKKLALQKNVICEKCEGVGGKKGSVEKCPLCKGRGMQIHIQQIGPGMVQQIQTVCIECKGQGERINPKDRCESCSGAKVIREKKIIEVHVEKGMKDGQKILFHGEGDQEPELEPGDVIIVLDQKDHSVFQRR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DNAJA4 (AAH21720, 1 a.a. ~ 397 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55466

Enviar uma mensagem


DNAJA4 polyclonal antibody (A01)

DNAJA4 polyclonal antibody (A01)