IMPACT purified MaxPab mouse polyclonal antibody (B01P)
  • IMPACT purified MaxPab mouse polyclonal antibody (B01P)

IMPACT purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055364-B01P
IMPACT purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IMPACT protein.
Información adicional
Size 50 ug
Gene Name IMPACT
Gene Alias MGC33718
Gene Description Impact homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAEGDAGSDQRQNEEIEAMAAIYGEEWCVIDDCAKIFCIRISDDIDDPKWTLCLQVMLPNEYPGTAPPIYQLNAPWLKGQERADLSNSLEEIYIQNIGESILYLWVEKIRDVLIQKSQMTEPGPDVKKKTEEEDVECEDDLILACQPESSVKALDFDISETRTEVEVEELPPIDHGIPITDRRSTFQAHLAPVVCPKQVKMVLSKLYENKKIASATHNIYAYRIYCEDKQTFLQDCEDDGETAAGGRLLHLMEIL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IMPACT (AAH34016, 1 a.a. ~ 320 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55364

Enviar uma mensagem


IMPACT purified MaxPab mouse polyclonal antibody (B01P)

IMPACT purified MaxPab mouse polyclonal antibody (B01P)