PI4K2A MaxPab rabbit polyclonal antibody (D01)
  • PI4K2A MaxPab rabbit polyclonal antibody (D01)

PI4K2A MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00055361-D01
PI4K2A MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PI4K2A protein.
Información adicional
Size 100 uL
Gene Name PI4K2A
Gene Alias DKFZp761G1923|PI4KII|PIK42A|RP11-548K23.6
Gene Description phosphatidylinositol 4-kinase type 2 alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP,IF
Immunogen Prot. Seq MDETSPLVSPERAQPPDYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPGSPGHDRERQPLLDRARGAAAQGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPEFEAVVRQAELAIERCIFPERIYQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PI4K2A (NP_060895.1, 1 a.a. ~ 479 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 55361

Enviar uma mensagem


PI4K2A MaxPab rabbit polyclonal antibody (D01)

PI4K2A MaxPab rabbit polyclonal antibody (D01)